SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009739 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009739
Domain Number 1 Region: 31-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.67e-26
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009739
Sequence length 158
Comment 158
Sequence
MDLAPGRRARLLVALALVVLVALAARSGAEVITLTEETFSDKITEVGRARRVQIKEKDTV
WFVKFCVPWCKHCKNLGTLWEDLGKVMEGADEIEIGQVDCGVSKPVCSKVDIHSYPTFKV
FYEGEEVAKYKGPRNVESLKNFVSDEAEKAGEAKLQDS
Download sequence
Identical sequences A0A0D3FH49 A0A0E0NTL3 A2XFE4
OsIBCD009739 OBART03G13290.1 39946.BGIOSIBCE010669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]