SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009771 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009771
Domain Number 1 Region: 31-158
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-43
Family Ran-binding domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009771
Sequence length 209
Comment 209
Sequence
MADPAEHREEEEEAAAAAAGEDEDTGAQVAPIVKLEEVAVTTGEEDEEVLLDMKSKLYRF
DKEGNQWKERGTGTVKLLKHKETGKVRLVMRQAKTLKICANHLVATTTKMQEHAGSDKSC
VWHALDFADGELKEEMFAIRFGSVENCKKFREMVEEIAEQQGKNEEKENEEVSSTAGLVE
KLSVTETKKEENAEKEETPAEEDKKDAKE
Download sequence
Identical sequences A0A0D9Z5U2 A0A0E0GL38 A0A0E0NTP8 B8ALM1 Q10MW8
ONIVA03G14840.1 OGLUM03G13680.1 LOC_Os03g18180.1|13103.m02177|protein 39946.BGIOSIBCE010701 39947.LOC_Os03g18180.1 XP_015627830.1.37577 OsIBCD009771 LOC_Os03g18180.1|PACid:21914085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]