SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009797 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD009797
Domain Number - Region: 25-72,107-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00682
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009797
Sequence length 258
Comment 258
Sequence
MAAIRLFRPALLLAAILLLAAGAVEGKKGGKVDVALYYESLCPYSAMFVVGSLAKVFRDG
LLDAVDLSLVPYGNARVKDGKISCQVEHGSEECFLNTVEACAIDAWPDLRVHFRFIYCVE
DLVVNHKQREWESCFGKLNLDPKPVTDCYKGERGHQLSLKYGRQTDALQPPHKYVPWVVV
DGQPLYEDYENFEAYICKAYKGHPPKVCEGLARPPTPTVLEVAEAVNRVSYYDSGDIRLK
PDEDGHAKIKKVVPDDDD
Download sequence
Identical sequences 39946.BGIOSIBCE010727 OsIBCD009797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]