SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD010191 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD010191
Domain Number 1 Region: 151-344
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00087
Further Details:      
 
Domain Number 2 Region: 40-102
Classification Level Classification E-value
Superfamily PH domain-like 0.0000401
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD010191
Sequence length 867
Comment 867
Sequence
MSSAPAAGGAFDRYQRAGAPAASGNTSTLPQRGGEVNVTLGGIDLNNSGSVVVREDKKLL
TVLFPDGRDGRAFTLKAETSEDLFEWKTALEEALAQAPNAALVMGHNGIFRNETTDTYDG
AIPNWREKRPIKSLVVGRPILLALEDIDGSPSFLEKALRFLEKYGIKVEGILRQAADVEE
VDRRLQEYEQGRTEFAPDEDSHIVGDCVKHVLRELPSSPVPASCCTALLEAFRLETKDAR
INAMRSAIVETFPEPNRRLLQRILKMMYTIASHTSENRMTASAVAACMAPLLLRPLLAGE
CEMDEVFDMDGDDSTQLLAAANAANSAQGIVTTLLEEYESIFDGEHNLRCSLSPESQIED
SGSEASTDDVNLDVKGNGFHDAENDVDQEMDDENGAERILSGKLSESSGYAGSDLYDYKV
VHADDSDAERSEDAKAAEVKIELSKGPKSHSTENGSAYMETLLSEKNPSNPISSHETPLS
MGEILSSLDPGISLANHSGEYSVESRQPAKINGSHPHVKRSNFWGRNNARKSQHSESVDS
SGEEELAIQRLEIAKNDLQNRIAKEEWLQARGNAILQASLERRKQALHERRLALEQDVSR
LQEQLQAERDLRAALEVGLSMSSSQFSSSRAMDTKTRAELEEIALAEADVARLKQKVAEL
HLQLNQQRQHQYGPMVDSNDRYHRIPGHFSQQNFVQPGFDMNLAFCNQEKQRNEESSVDS
SQWRNIKQHVLPYGSSRPLTRKLSLDASSSDSRGMEASTSMPTDNTAMAINAPKFTEVRE
ITATLFSTTNILQRKIVLIFIVWQGVDYGRQPMVASSTLVELTTRLDFFKERRSQLMEQL
HSLDLGHGSASQGFPYNKPPSPWDSPR
Download sequence
Identical sequences OsIBCD010191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]