SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD010509 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD010509
Domain Number 1 Region: 134-226
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.49e-31
Family eEF-1beta-like 0.0000342
Further Details:      
 
Domain Number 2 Region: 8-65
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000681
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD010509
Sequence length 254
Comment 254
Sequence
MAITLSNVNSEAGLQKLDEYLLTRSYISGYQASKDDMTVFTSLPSAPAASYVNVTRWYDH
ISALLRSSGVTAEGEGVKVESTACSVSPTADQKAPAADEEDDDDVDLFGEETEEEKKAAE
ERAAAVKASGKKKESGKSSVLLDVKPWDDETDMAKLEEAVRNVKMEGLLWGASKLVPVGY
GIKKLQIMMTIVDDLVSVDSLIEDYFYTEPANEFIQSCDIVAFNKICKFPGKFGAFSLDF
QITETNGLIEYAKL
Download sequence
Identical sequences A2XHU1
39946.BGIOSIBCE011500 OsIBCD010509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]