SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011080 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011080
Domain Number 1 Region: 10-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.87e-36
Family DsbA-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011080
Sequence length 218
Comment 218
Sequence
MASNAGKKLIQIDVSSDTVCPWCFVGKKNLEKAMEQNKDKFDFEVRWHPFFLNPNAPKEG
IKKSDYYRMKFGPIQFEHATARMTEIFRGLGMEYDMSGLIGNTMDSHRLITLAGHQGYDK
QSALVEELFQSYFCHGKFIGDRQVLLDAARKVGIEGAEELLQDSNKGVDEVKEELNKYSS
GISGVPHFVINGKFQLSGGQPPNAFTRAFDVAAKDGAQ
Download sequence
Identical sequences OsIBCD011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]