SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011311 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD011311
Domain Number - Region: 351-457
Classification Level Classification E-value
Superfamily PH domain-like 0.000521
Family Pleckstrin-homology domain (PH domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011311
Sequence length 471
Comment 471
Sequence
MGDHHHHHHPRRGSRHAAAGDLRPPEPPLDPLEFLSRSWSASASALDAPRPPPPAPSPSA
VLGIGPIAEDAATAACEVVDDGSAFAAAGSSFSFASAATSQLIMERILAQSEVAPLTSGR
LSHSSGPLTGGGSITDSPPVSPEIDDAKYCRAASTPKPQMYRGGNKTVGRWLKDRKEKKK
EETRAHNAQVHAAVSVAAVAAAVAAVAAATAAASGSGKDDRAARTDMAMASAATLVAAQC
VEAAESMGAEREHLEAVIGSAVNVRTPGDIVTVTAAAATALRGAATLKARALKEVWNIAA
VIPVEKGTMGGGHHHKQNMQKQHRKLESNGSSISDDLSLEEENNFLGICSQELLARGTEL
LKRTRKGALHWKVVSVYINRMGLVMLKMKSRHVAGTITKKKKSVVIDVCKDVAAWPGRHL
LEDGEHRRYFGLRTAEHRVIEFECTSQREYEMWTKGVARLLIIASERKRAP
Download sequence
Identical sequences A2XJW6
39946.BGIOSIBCE012214 OsIBCD011311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]