SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011491 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011491
Domain Number 1 Region: 330-473
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-17
Family Ran-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011491
Sequence length 477
Comment 477
Sequence
MADGYRRRALMAALTLVPATCGSAGGMPCVPAARGGGRKLLGVATGGGRQLRCGWPRKDV
ESAFQMADRRGKVSGLIRQPLTKGKTSCGGVRVSLPSKRVMDRPSFGVHRAESSHQHMMA
GPATLDPQRAEAANKHVRALNSQFASWVQSQLQNHPAELWEDGMRDYISHASEIMEKFKD
VVNWIKQNKTGSAVVLSPGPPNDEKTISPAAVDSKFTVQSSPDNGQKGPVTAASSPAFQN
SSSPNLFSFASHQKTPAFTGIFGDKKNMPGDSNKPSFQFGANNGFSTPSMPSIFSASGAQ
SFSMPSQTLFSVNQQPAISGNKSAAEASGDADEDAEPEQPSSPSVKKAEEKGIVVVYEAK
CKVYVKHDDPANGWKDIGVGQLNIRCKEGAEKASKESTPTIVIRNDVGKILLNALIYKGI
KMNVKKSTVASIFHTSDGQPSESGSATVVARTYLIRVKNDEAAAKLSAAIMENAPLE
Download sequence
Identical sequences OsIBCD011491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]