SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011715 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011715
Domain Number 1 Region: 427-611
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-59
Family Oxysterol-binding protein 0.0023
Further Details:      
 
Domain Number 2 Region: 710-879
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.01e-34
Family Oxysterol-binding protein 0.0062
Further Details:      
 
Domain Number 3 Region: 90-121,148-227
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  OsIBCD011715
Domain Number - Region: 38-49
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000256
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011715
Sequence length 885
Comment 885
Sequence
MHPFCCVPPVPVSPAASAAAAATPAASSAVAGAPAVMPPPPPPLPPPPPRSNSAPPERRA
LRWAAGGGSGAGNSPPEGVKLNEIVGGGISGILYKWVNYGRGWRPRWFALHDGVLSYYKI
HGPDRIVLSRETERGAKVIGEDSLRRLSRPSTSSSSSAHSNGHHLPRKPIGEIHLKVSSV
RESRSDDRRFSIFSGTKRLHLRAETREDRAAWVEALQATKEMFPRMSTSEMVGPGDTAAA
VAVSTERLRQRLQQEGVSEAAIADSERIVRTEFEVLHKQLMLLKQKQTLLLDTLRQLETE
KVDLENTLVDESQRQSKEYGSTSRSKNEKYSEGSASESDDYNEPQDPAEDETDDDENIYF
DTRDFLSSSSFKSSGSDFQRSEAGSDDEDDYPMDGIDTSMKSVGISYPYVRRRKKLPDPV
EKEKGKCFEDLEYSYLIDRAYEWGKRGNSLMRILSVAAFAVSGYASTDGRSCKPFNPLLG
ETYEADYPDKGLRFFSEKVSHHPMVVACHCEGTGWRFWADSNLKSKFWGRSIQLDPVGVL
TLEFDDGEVFQWSKVTTSIYNLILGKLYCDHYGTMRIQGNNEYSCKLKFKEQSIIDRNPH
QRDYVISVVVTLKQQGTQKKARQCLALPHRRMKGARAKENGMEGSRMLIKVAVTSSLPQL
TCCHRSHTLPSDVDPDCSCCSLQLLNLWWWQWTASHLMWHRFASRLTCYGAETEVQGVVQ
DRSGRTVATLFGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFA
ITLNELTAGLKEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKP
RWFAKDKATDTYRYLGGYWESREKGSWEGCPDIFGQVPNDLMITD
Download sequence
Identical sequences OsIBCD011715 39946.BGIOSIBCE012672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]