SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011910 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD011910
Domain Number - Region: 97-133,161-223
Classification Level Classification E-value
Superfamily PH domain-like 0.0897
Family GRAM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011910
Sequence length 225
Comment 225
Sequence
MATSWAAPPPGYPYAQGQGGAQPPHPPQSTAVAVTPVSNGVGNPYVIVTPASASPSTCQF
RTAPNMADAAVARLAQGTKVYAEGGHDRVFTQAFGVVPGEQLRKAYACYLSTSSGPVIGT
LYISTARLAFCSDSPISYHAPAVAVAGAAPAHPPEAIYKATTFFIASVVLPLNQVKSVNP
SASMTNRGERYIQIMTTDNHEFWFMGFVSYDKALKNLYEALQRRA
Download sequence
Identical sequences A0A0E0GCV5
OsIBCD011910 ONIVA02G34850.1 39946.BGIOSIBCE012889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]