SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011949 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011949
Domain Number 1 Region: 445-733
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-124
Family BEACH domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 763-987
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.61e-24
Family WD40-repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  OsIBCD011949
Domain Number - Region: 326-368
Classification Level Classification E-value
Superfamily PH domain-like 0.00541
Family Pleckstrin-homology domain (PH domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011949
Sequence length 1016
Comment 1016
Sequence
MDILHGGLDKLLTGSTTAFFEWLQSSQQTISKVLDQCALIMWVQYITGSAKFPGVRIKGM
EVRRKKDMGRKLREIAKLDSRHWEQINERRYNLDLVRDVMSTELRAIRQDKYGWILHGES
EWQSQLQQLVHERGIFPVRQLSTEPAWQLCAVEGPYRMRKKLEPSKFKIDTIHNVLASNL
GLDDVKITKKEDGHMVMTSGSDTMSGLNLLTYDTERKDLDAADFASFKDEDDIFKGGSTV
SPPIGWTDDKSSINEQSLHSATEHGAKSSSFSYHMTESVHGKSEFNSPRRAPSVKGTDTR
TSEDKSEKELLDNGEYLIRPYLEPSEKIRHKYNCERVAGLDKHDGIFLIGELSLYIIENF
YIDDSNCIYEKGNEDELSVIDQALGCKKGCIGKLRFSPKITMYVGCNSKSFAWWQSMGIQ
WRCLGLDTTISASSKQDSGEGSRLFKIMAKSFSKRWQSGEITNFQYLMHLNTLAGRGYSD
LTQYPVFPWVLADYESDTLDLRNPQTFRKLDKPMGCQTEGGEEEFRKRYDSWDDPEVPKF
HYGSHYSSAGIVLFYLLRLPPFSMENQKLQGGQFDHADRLFNSVKDTWVSAAGKSNTSDV
KELIPEFYYLPEFLENQFNLDLGEKQSGEKVGDVVLPPWAKGSSREFIRKHREALESDYV
SENLHHWIDLIFGYKQRGKAAEDAVNVFYHYTYEGNVDIDSVSDPTMKASILAQINHFGQ
TPKQLFQKPHPQRRTDRKVLPHPLRYSAYLTHQEIRKTTSSVSQIVTYNDKILIAAANSF
LKPVNYSEYISWGFPDRSLRILTYDQDKLVSTHENLHGGSQIQCTGVSHDGNILTTGGDD
GVVAVWRFFKDGTRRLLRMEKALCAHTAKITCIYVSQPYSLIVSGSDDCSVILWDLTSLA
FVKQLPRFPASVSALHVNNLTGEILTGAGVLFAVWSVNGDCLAVVNTSQLPSDLILSVAS
TTNSDWQDTNWYVTGHQSGAVKVWKMVHYTSDEAANSKSKSPPSTLGGMSLNGQTQ
Download sequence
Identical sequences B8AJU7
OsIBCD011949 39946.BGIOSIBCE012929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]