SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012287 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD012287
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-30
Family Thioltransferase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012287
Sequence length 134
Comment 134
Sequence
MGSFFSTMFTPPPAADDGGDSRVVAVHSTATWDEQWGAHKSNPNKLIVIDFSATWCGPCR
FIEPAFKDMAGRFADAVFFKIDVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDE
LERKVNMFISSSSS
Download sequence
Identical sequences A0A0E0GV23 A0A0E0P2N0 B8ALD1 Q851R5
ONIVA03G39070.1 LOC_Os03g58630.1|PACid:21917582 OsIBCD012287 XP_015631704.1.37577 LOC_Os03g58630.1|13103.m06438|protein 39946.BGIOSIBCE013316 39947.LOC_Os03g58630.1 OMERI03G34320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]