SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012314 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD012314
Domain Number - Region: 2-13
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012314
Sequence length 207
Comment 207
Sequence
MPPPPPPHPLPSPCRRRRCLLLLLLSRLLLSSASSLEEGRVLTVGEELMGETMPLRHGSR
LYRLDGTRPSAWYEVKISYPASIPSSFSIRLVDDPHSVEDLGSMNRRLLNTEKIIFKAQS
SRPVYVLVTVEPEGVVAKPNVPERELAMFNIVCDELMLGIPHFAWWVGIGSLFCIALASV
APYFLPLHKLLNYEATELSDDFAAKLS
Download sequence
Identical sequences A0A0E0P2R5 A2XN27 Q75HK3
LOC_Os03g58930.1|PACid:21916019 XP_015632946.1.37577 39946.BGIOSIBCE013341 39947.LOC_Os03g58930.1 OsIBCD012314 LOC_Os03g58930.1|13103.m06471|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]