SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012341 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD012341
Domain Number 1 Region: 53-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000017
Family Thioltransferase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012341
Sequence length 186
Comment 186
Sequence
MTRCAVVAAVAAVLLIAGAAAAGGGEEEEAPSTCARRGPGFVDALASRCPCIRIEPSPPV
EVRGEAIDKELNLRRRGVTYSVLFYAAWCPFSSKFRPIFEALSTMFPQIYHFTVEESSAM
PSLFSRYGVRGFPAILLVNETTMEKGTGRRIGTGVRRDGLWYINHEELGLAAVVGDVEKE
ISLLHC
Download sequence
Identical sequences OsIBCD012341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]