SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012543 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD012543
Domain Number 1 Region: 30-165
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-32
Family Dcp1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012543
Sequence length 477
Comment 477
Sequence
MARGGSGGGRWRRLNVRPDLASDQEGTRTLNLTVLRRLDPAVADILIIAAHVVLYSFDDN
IHQWLLTADLINNADVFGISEKGIVMNFWKITASWNTQPRFQFIVMNRKNTENLTEDLLG
GFEYQVQVPYIMYHNAADEITGIWFYDPQECEQVGYLFSRIQKAFSRVSPKAKVSVTESE
YEKPEVVPAVPSNEDTLKQPTSSIMLLDNAKYDFLSALLKGAACVGATMDEASAVQSNKS
VGMVHSSTHASPHAIPPQSPAIQSNKSFGMVHSSTQAPLAIPPQSPAIRSNKSVGMIHSS
THASPFDIPPQSPAVQSNKSVGMIHSLTHASHLAIPPQSPALHGLHPSQISAVPVMPHDA
HRSSSTSTIQPTSLANPLFFPPMPSLQTASHAASSLCSAAPLHPPITVQQLQSAPLHQPF
SLPTASSIQPPYGMPLLQPFPPPNPSPFLTSGVSYGRPVITRDQLKDVLLSLCQVCS
Download sequence
Identical sequences 39946.BGIOSIBCE013597 OsIBCD012543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]