SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012770 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD012770
Domain Number 1 Region: 21-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000883
Family DsbC/DsbG C-terminal domain-like 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012770
Sequence length 98
Comment 98
Sequence
MEARHRVMSLLLVLVIGCCAWGCRPGAAQVPVPARTDGFVYGGKAPALGETVVVEAYFDP
VCPDSRDAWPELKKAVEHYASRVTVVVHLFPLPIIKLN
Download sequence
Identical sequences A2XPG4
39946.BGIOSIBCE013829 OsIBCD012770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]