SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD013645 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD013645
Domain Number 1 Region: 68-176
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.73e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 190-302
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 2.5e-27
Family DHN aldolase/epimerase 0.0000026
Further Details:      
 
Domain Number 3 Region: 4-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.18e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD013645
Sequence length 304
Comment 304
Sequence
MVTRSPWFLEEVGLPYRIHRVNISAGEQFKPDFLSISPNNKIPAIVDQQPVDGGAPISLF
ESGEILLYLAEKTGKLLSKGLRERAATLQWLFWQVAGFGPMLGQNHHFNHYAPQPVPYAI
ERYHLETKRLYGVLEAELQKHPYLGGDNYSIADIATYPWVVSHPRQRIDLADYPATYGES
LMSFSQPDAVIRIKNLRLRTFIGIKEEEINNRQDVLINVVIHYPADKARNSEDIADALNY
RTITKAIIRHVEDNRFALLEKLTQDVLDIVKEHAWVTYAEVEIDKLLALRYADSVSMTMS
YRRD
Download sequence
Identical sequences OsIBCD013645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]