SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014262 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014262
Domain Number 1 Region: 14-164
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.76e-63
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000288
Further Details:      
 
Domain Number 2 Region: 231-426
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-58
Family BC ATP-binding domain-like 0.0000000675
Further Details:      
 
Domain Number 3 Region: 430-505
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.77e-21
Family BC C-terminal domain-like 0.0000444
Further Details:      
 
Domain Number 4 Region: 164-226
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.00000000719
Family BC N-terminal domain-like 0.0000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014262
Sequence length 507
Comment 507
Sequence
MGANAASAANAGAKIAIVMGSKSDWATMQFAAEVLTQLDVPFHVEVVSAHRTPDKLFSFA
EQAAANGFDVIIAGAGGAAHLPGMLAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIP
VGTLAIGKAGAANAGLLAMQILALHDAALAQRLADWRQAQTEDLGRMLRQAGEPLGIAVY
PVGIDAEPEAVPYQNSVITAEIERWPETALTRELATHSAFVNRDIFPRLADRLTQKQLLD
QLGLATAPWQLLASAAEWPQVFAALGELAIVKRRVGGYDGRGQWRLRPGQEAELPADAYG
ECIVEQGINFSGEVSLVGARGHDGRSVFYPLTHNLHEDGILRASVALPQPNPALQQQAEQ
MLAAILNELNYVGVMAMECFIVGDRLLINELAPRVHNSGHWTQNGASISQFELHLRAILG
LPLPQPVVSTPSVMVNLIGTAVNEQWLSLPLVHLHWYEKEVRPGRKVGHLNLNDPSAADL
RQALQALAPLLPGEYQSGLAWAQQKLA
Download sequence
Identical sequences A2XT74
OsIBCD014262 39946.BGIOSIBCE015095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]