SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014285 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014285
Domain Number 1 Region: 22-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-33
Family Glutathione peroxidase-like 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014285
Sequence length 155
Comment 155
Sequence
MACAFSVSSAAAPLASPKGDLPLVGNKAPDFEAEAMFDQGFIKSKCMFVSSAEITAFSDR
YEEFEKINTEVLGVSIDSVGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQ
YVQENPDEVCPAGWKPGEKSMKPDPKDSKEYFASI
Download sequence
Identical sequences A3ATR3
39946.BGIOSIBCE015124 OsIBCD014285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]