SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014397 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014397
Domain Number 1 Region: 140-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.03e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000128
Family Glutathione S-transferase (GST), N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014397
Sequence length 390
Comment 390
Sequence
MQLYHHPYSLDSQKVRMALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH
VIYRAFDIIQYLDRLSVHLSGEIVPVNTEVYQWMQKVDSWNPKMFTLTHTPIKYRTFVSK
FIRRVLIARMAEAPDLASMYHAKLREAYETEDKLKDPDIMKQSEEELSKLLDDVEAQLNN
GKYLAGDEFSPADSVFIPILARITLLDLDEEYINCRPRLLEYYTLVKQRPSYKVAIGKFF
GGWKKYRTLFKTSFFLCVKLCTTMPLFALLHYIVYKYLGAGDLEQLSLLVSEFQDKSEPG
RGRKREPKSSGNGNMEESLKTKFLPPAMEVEICSHDYFNGEIRTHILDSLRSSKAGSEEE
EKRAKEQWAWGHEGMLKPLSNPRMRLEMEL
Download sequence
Identical sequences OsIBCD014397 39946.BGIOSIBCE015259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]