SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014450 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014450
Domain Number 1 Region: 323-459
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-51
Family G proteins 0.0000011
Further Details:      
 
Domain Number 2 Region: 132-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000244
Family Thioltransferase 0.05
Further Details:      
 
Domain Number 3 Region: 219-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000804
Family ArsC-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014450
Sequence length 532
Comment 532
Sequence
MLPLARPVHHHHHPRLCPTAPWRSPPPARGARLRSRARGPQTLAARARPPRAEAGEAETA
AGGTGATTTTGGGGGSVLSFLCPLLKLLGGGDPSQERNDIVEVATSSLSSLARLPWGSSV
STSSENNVNPTTKACPFCRRVREAMTELDLSAEVYPCPKGSLRHRDVVKKIGGKEQFPLL
VDASNGVTITILTGWVPTLLRAGRGMTLWNKAGVVPEDKLELFSFENNTYARIVREALCE
LEVPYILQNVGEGSSKMDLLQKISGSKQVVSHILTTFLFLESLLSSSVQASILFLLLPAD
TFDPEQKKLQKWVKSGRAMNNEFDYLFKLLLIGDSSVGKSCFLLRFADDSYVDSYISTIG
VDFKIRTIEMDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDITDMESFNNVKEW
MSEIDNYANDSVCKLLVGNKCDLAESRVVETAVAQVALQTLLHYGWLIHAEVMLYFVKLN
EKKIWEPGSPGEEGIQSSSDERSANSATAAATEEQLLFIVMAQWSGIFHELG
Download sequence
Identical sequences OsIBCD014450 39946.BGIOSIBCE015318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]