SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015060 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015060
Domain Number 1 Region: 72-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-36
Family Thioltransferase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015060
Sequence length 180
Comment 180
Sequence
MASALAASTAVCSSPLASASASASSARRLRAVPPSRGIRYQALRADSGFAGNRRGGGRGA
SVVCAVQGQDTSIQVPEVTKSTWQSLVMESELPVLVGYWATWCGPCKMIDPVVGKLSKEY
EGKLKCYKLNTDENPDIASQYGVRSIPTMMIFKNGEKKDAVIGAVPESTLIASIEKFVER
Download sequence
Identical sequences A0A0E0PBW7 A2XVT3 Q25AG7 Q7X8R5
LOC_Os04g44830.1|PACid:21893474 39946.BGIOSIBCE015992 39947.LOC_Os04g44830.1 LOC_Os04g44830.1|13104.m04483|protein OsIBCD015060 XP_015633750.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]