SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015373 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015373
Domain Number 1 Region: 224-608
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-89
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 2 Region: 1106-1176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.94e-17
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 3 Region: 610-678
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 4 Region: 14-93
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000922
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015373
Sequence length 1178
Comment 1178
Sequence
MAGSFDGRMPTRGVEQAIVALKKGAHLLKFGKRGKPKFCPFRLSSDEKTLVWYSKDREKH
LSLNSVSTVVLGQKTICRDRDQAECWFLGLTALTSSPYSPLPLAGSKSGRQINSCAISPR
SYLQRKCRLSAALDTPRHTQVYPSYGSPKIIQKKIFGGNLDSSEALFYPRHPTFCDIDSY
IEKLNPKIATPVKHGLKDIMVANRRAQNITHTPKLKTFEGPRVACRLDSLKDVFLWGSVL
GSMLGSEDIPKSLPRLVGSAKMLDVQSIACGENHAAIITKQGEVYTWGSYSSGRLDQKVN
VNASCPKMVESLASVHVKAVAFGSKHTCAITVSGELFEWGEGAHSLGLMNDWYGRNQWFP
HKFLGPMDNISVSKIACGEWHTAIITSSGQLFTYGDGTFGVLGHGDTQGVARPKEVESLK
GSRVKSVACGPWHTAAIVEVMSSFKGNAPSGKLFTWGDADRGKLGHADRKMKLLPTCVDS
LTAYDLIQVSCGTAVTVVLTVTGMVFTIGSSRHGQLGNPKADGESICSVEGPLKTEFVRE
ISSGSSHVAVLTMSGKVFTWGKGAEGQLGLGDYSNRSSPTLVEALEGRDVESVVCGFNFT
AAICLHKTMSMKDQSVCSSCQMVFGFTRKKHNCYNCGSMFCSSCTSNKITMAALAPDTNR
RYRVCDACFYQLQKVVDSSKDKSRLKISKGEMFKLELKAYTPKLSRLFKEANFFAEKMAS
VQGTNQRNEEPATAVQTKTERWGQVECPALFISAQDSFQTQPVSNSEGCAISFSQRMHDS
AVLKSGVSLRFTDAQREEIEMMQTELQGQVKQLHSQVAVLTEQCQQKSVMVQLYKQKLDD
TWLVVRDEAARCKAAKDIIKVLTDQCNALSEKLSIGQLSENSKITPNSIPMQPTKIELQG
NTGRNLVTRKLGQLNNTQNHGSSIQTEKECVPLSNAVVPEDVPFSQQNGARKFSSDGYTT
EAPLAAPPTDSVTEQIEHGVYVTFSTSSCGKKDIKRIRFSRKHFGEKEAQHWWEHNKTRV
YDNYKFETLRIRFLFGGRKPPTLTLSEKAKTTPERLKPSGYHPLRAGAMAGARAAVIPVA
APPRTISVSLAASPSSSHPLRPVASSGLSFRTTEESLRNAFERFVNLVMERVAKRPRGFA
FLSYASEEESKNAMEGMQGKFLDGRVIFVEVARQRSEL
Download sequence
Identical sequences 39946.BGIOSIBCE016348 OsIBCD015373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]