SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015937 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015937
Domain Number 1 Region: 898-1247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-120
Family Motor proteins 0.0000000000998
Further Details:      
 
Domain Number 2 Region: 373-490
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-21
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 495-583
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000012
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Domain Number 4 Region: 839-922
Classification Level Classification E-value
Superfamily Prismane protein-like 0.0000156
Family Acetyl-CoA synthase 0.021
Further Details:      
 
Weak hits

Sequence:  OsIBCD015937
Domain Number - Region: 271-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0589
Family Ubiquitin-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015937
Sequence length 1274
Comment 1274
Sequence
MAAGGVGGSNGAATAATPLHGSATSSMNGGGASGGDGYDSDGYSFAPPTPTTLSMSIPPE
LAGAIPLIDRFQVEGFLKAMQKQIHSAGKRGFFSKKSVGPHVREKFTLEDMLCFQKDPIP
TSLLKISSDLVSRSIKLFHVILKYMGIDSPAIISLDERIELVAKLYKHTLKRSELRDELF
AQISKQTRNNPDRAWLIRAWELMYLCASSMPPSKDIGAYLSEYVHYIAHGATTDSDVRVL
ALNTLNALKRSVKAGPRVTIPAREEIEALLSSRKLTTIVFFLDETFEEITYDMATTVADA
VEELAGIIKLSVYSSFSLFECRKVVNGSKSSDVGNEEYIGLDDNKYIGDLLSEFKAAKDR
NKGEILHCKLVFKKRLFRESDEAITDPMFVQLSYVQLQHDYILGNYPVGRDDAAQLSALQ
ILVEIGFVDNPESCVEWISLLERFLPRQVAITRAKRDWELDIVSRYQLMEHLSKDDARQQ
FLRILRTLPYGNSVFFSVRKIDDPIGLLPGRIILGINKRGVHFFRPVPKEYLHSAELRDI
MQFGSSNTAVFFKMRVAGVLHIFQFETKQGEEICVALQTHINDVMLRRYSKARSATSAVS
QNDVSQTYKPPNIEIYEKRVQELSKAVEESERKADLLNEELQKKTKQERDMQKELEGLRD
TLQSERQSIKEVTNDLDKLKSLCDEKDSSLQASLMEKTRLETRLKSGQGQESSNRTGVSG
NHFERDTLPTVGTVNNSIEMLAKLEEELKSCKKELDASKELSKKLTMENNLLDQKVQRLE
RAKSEEKSNMERVYEDECCKLKSRIAELEQKLESRTRSLNVTESTLALRNAEVDTLQNSL
KELDELREFKADVDRKNQQTAEILKRQGAQLIELENLYKQEQVLRKRYYNTIEDMKGKIR
VFCRLRPLNDKELTEKDKNIVCSPDEFTVAHPWKDDKSKQHIYDRVFDANTTQEEVFEDT
KYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGSENNPGLTPRATSELFRVIKRDGHKYSFS
LKAYMVELYQDNLVDLLLAKNATRQKLEIKKDSKGVVTVENVTVVNISSFEELRAIILRG
SERRHTAGTNMNVESSRSHLILSIIIESTNLQTQSYARGKLSFVDLAGSERVKKSGSAGK
QLKEAQSINKSLSALADVIGALSSDGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAE
SNLEETYNSLMYASRVRCIINDTSKHVAPKEIMRLKKLIAYWKEQAGKRSEDDDLEEIQE
ERTPKEKADNRLTS
Download sequence
Identical sequences A2XYQ1
OsIBCD015937 39946.BGIOSIBCE016984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]