SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015948 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD015948
Domain Number - Region: 68-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000188
Family Thioltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015948
Sequence length 209
Comment 209
Sequence
MASSLARMGAALPRVRPRAAARFPPPPGRWDSAAALRRAPVYGFRCQVHSDVKVGPSSGL
KDGENSSGSWRIKMLYDGDCPLCMREVNMLRERNKSYGAIKFVDISSKDYSPQDNQNLDY
ETAMGRIHAILSDGTIVTDVEAFRKLYEEVGLGWIYAVTKYEPVAKVANAIYGVWAKYRM
QITGRPPLEEIMESRKLAAECKDDKVCKM
Download sequence
Identical sequences A0A0D9ZS63 A0A0E0G765 A0A0E0PFF2 A2XYR8 I1PQQ5 Q259Q0 Q84P94
39946.BGIOSIBCE017001 39947.LOC_Os04g57310.1 OGLUM04G28830.1 XP_015633461.1.37577 LOC_Os04g57310.1|13104.m05991|protein OsIBCD015948 ORGLA04G0252400.1 ONIVA02G19640.1 LOC_Os04g57310.1|PACid:21895400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]