SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016324 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016324
Domain Number 1 Region: 24-212
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.04e-67
Family Cellulases catalytic domain 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016324
Sequence length 212
Comment 212
Sequence
MAGRAMLVALVVIATSCMVHDAHGHDYRAALAMSLLYFEGQRSGRLPPAQRVQWRADSAL
ADGADHRVDLTGGYYDSGDNVKFGLPMAFTVAALAWSVVEYGGRLDAAGELGHALDAVRW
GADYLARAHASAGGGGGGEALYVQVGDGDSDHSCWQRPEDMDTPRTAYMVTASSPGSDVA
AETAAALAAAAVALTPADANFSSTLLVHAKQL
Download sequence
Identical sequences OsIBCD016324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]