SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016384 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016384
Domain Number 1 Region: 319-392
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000816
Family Thioredoxin-like 2Fe-2S ferredoxin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016384
Sequence length 416
Comment 416
Sequence
MELTGAAIRGSLATAASPVVLRGRGRRCAARVSCVGRGGGGFGDEGHLRYYEAPPRKAVE
AVARDLAKLRAMGIASGDAAKEKVLSEATELLLEELNRMRDEEGELKKKMKEDKDAMKAL
KKQQKEAMKAATTMKCDDDDSSESSESSESECEEQMMTMSCVASVTMPQIGEGVAISTTV
PQVAASDVATAPAMEYDQAAMKAMKKREKEEKKAAKMAMKMKKKEKKMATLTLCKDEDST
SCSSESSDSECEEVVRMSRCATITTPQTQPSSTVFPIILPQIPESVTLEPCQDAQISSEP
ANTMLSTTATIAVVEKPMTNRIEVCMGGKCKKSGSLAVLQEFEKKVGTDGAVVGCKCLGK
CGLGPNVRLRSEGAAQKNPLFIGVVLEDVGTIASGLFGGGDDLGMVNNLAQPLPYL
Download sequence
Identical sequences A2Y067
39946.BGIOSIBCE017487 OsIBCD016384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]