SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016450 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016450
Domain Number 1 Region: 73-213
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016450
Sequence length 217
Comment 217
Sequence
MVAKVYGVAASPYAATVLVCLEEAGASYELVAVDMAAGENRSRHHLARSPFGKIPAFEDG
EVTLFESRAIQRYVLRNYNKPDLLREGNLEESAMVDMWMEVEAHHYDPAISHIIRECVIK
PMIGGGARDQAIVDENVEKLRKVLEVYERRLSESEYLAGDFVSVADLNHFPYTYYLMTTE
YATLVESCTNVKAWWERLLARPAVRKVAALFPPVTST
Download sequence
Identical sequences A0A0E0H9E9 A2Y0E7
ONIVA05G03270.1 OsIBCD016450 39946.BGIOSIBCE017569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]