SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016505 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016505
Domain Number 1 Region: 147-257
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.12e-39
Family PDI-like 0.0023
Further Details:      
 
Domain Number 2 Region: 30-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.21e-36
Family PDI-like 0.0037
Further Details:      
 
Domain Number 3 Region: 270-364
Classification Level Classification E-value
Superfamily ERP29 C domain-like 2.09e-28
Family ERP29 C domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016505
Sequence length 366
Comment 366
Sequence
MATPQISRKALASLLLLVAAAAAVSTASADDVLALTESTFEKEVGQDRAALVEFYAPWCG
HCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKY
EGQRTAEALAEYVNSEAATNVKIAAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGH
CKHLAPIYEKLASVYKQDEGVVIANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYD
GGRELDDFVKFINEKCGTSRDSKGQLTSEAGIVESLAPLVKEFLGAANDKRKEALSKMEE
DVAKLTGPAAKYGKIYVNSAKKIMEKGSEYTKKESERLQRMLEKSISPSKADEFVIKKNI
LSTFSS
Download sequence
Identical sequences A0A067Y3P4 A0A0E0PHS3 B8AYG0 J7LG00 Q75M08
LOC_Os05g06430.2|13105.m00688|protein XP_015640375.1.37577 OsIBCD016505 39946.BGIOSIBCE017629 LOC_Os05g06430.2|PACid:21940418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]