SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016581 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016581
Domain Number 1 Region: 17-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-32
Family Thioltransferase 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016581
Sequence length 132
Comment 132
Sequence
MGGCVGKGRRHIEEDKLDFKGGNVHVITSKEDWDRKIEEANKDGKIVVANFSASWCGPCR
VIAPIYAEMSKTYPQLMFLTIDVDDLMDFSSSWDIRATPTFFFIKNEKQVDKLVGANKPE
LEKKVQALADGS
Download sequence
Identical sequences A0A0D9ZUQ4 A0A0E0HA45 A0A0E0PI29 A2Y0T3 Q0DKF1
LOC_Os05g07690.1|PACid:21943211 LOC_Os05g07690.2|PACid:21943212 ONIVA05G05050.1 39946.BGIOSIBCE017706 39947.LOC_Os05g07690.2 OsIBCD016581 XP_015640764.1.37577 LOC_Os05g07690.1|13105.m00837|protein LOC_Os05g07690.2|13105.m00838|protein OGLUM05G04560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]