SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016679 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016679
Domain Number 1 Region: 204-440
Classification Level Classification E-value
Superfamily PH domain-like 8.85e-77
Family SSRP1-like 0.00000695
Further Details:      
 
Domain Number 2 Region: 544-626
Classification Level Classification E-value
Superfamily HMG-box 6.02e-24
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016679
Sequence length 640
Comment 640
Sequence
MTDGHHFNNISLGGRGGNNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMAIPRSY
QLGVSTKEGLFYRFFGFREQDISSLTNFMEKNMRITPEEKQLSVGGHNWGGIEINGNMLS
FNVGSKEAFEVSLADVAQTQMQGKTDVVLEFHVDDTTGGNEKDSLMDLSFHVPTSNTQFP
GDENRPSAQVLWQAILNKADVGSSEEAVVTFDGIAILTPRGRYSVELHLSFLRLQGQAND
FKIQYSSILRLFVLPKSNNPHTFVVITLDPPIRKGQTLYPHIVIQFETEAVVQRDLTLSD
EVLAEKYKDRLENSYQGLIHEVFSKVLRGLSGAKVTRPSTFRSCQDGYAVKSSLKAEDGL
LYPLEKGFFFLPKPPTLILHEEIEYVEFERHGAGGASISSHYFDLLVKLKNDQEHLFRNI
QRNEYHNLFNFISGKHLKILNLGEAQGRAGGVTAVLQSTDDDAVDPHLERIRNQTGDDES
DEEDEDFVADKDDSGSPTDDSGEEGSDASLSGGEKEKSSKKEASSSKAPLKKRKPKGGDA
AEGSEKRKPKKKKDPNAPKRAIAPFMYFSKAERANLKNSNPELATTEIAKKLGERWQKMT
AEEKQPYVEQSQVDKKRYAEESAAYRGAAAMDVDSGPASD
Download sequence
Identical sequences A0A0D3G3Z1 A0A0E0PIC5 A2Y138 Q65WY8
39946.BGIOSIBCE017808 39947.LOC_Os05g08970.1 OBART05G05520.1 XP_015637672.1.37577 LOC_Os05g08970.1|PACid:21941073 OsIBCD016679 LOC_Os05g08970.1|13105.m00995|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]