SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016750 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016750
Domain Number 1 Region: 77-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-26
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016750
Sequence length 224
Comment 224
Sequence
MAEALLPLPRRLVVTASTPACSSASSSTSPSPHCLLSRANPRPPRLAAPSPPRHRRLKDF
IYVLATAHAAVSDKSEQPKWWEKNAGPNMIDIHSTQEFLDALRDAGDRLVIVEFYGTWCG
SCRALFPRLCRTAVENPDILFLKVNFDENKPMCKRLNVKVLPYFHFYRGADGQLEAFSCS
LAKFQKLKDAIAVHNTARCSIGPPVGVGDVLDSPEEKPAEASPR
Download sequence
Identical sequences A2Y1C0 B9FIK8
OsIBCD016750 39946.BGIOSIBCE017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]