SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD017593 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD017593
Domain Number 1 Region: 530-653
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-28
Family Ran-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017593
Sequence length 673
Comment 673
Sequence
MTPTTTPRPWVLRASPPHHHQQQPAQTAAVDMQDAAGALAAQFLPQGWAVDEFLQFSDYE
TVDKASPPQPPARLPKKEKRGVKEREMRKGKREEADVATLTCGAHVGPTLTQQPRGFAGR
SHSLLAAAAAAAVVEGEAAALRLGSGGAPAPLSGHAPVSAIRPSAPPFDLVPWSLPTPPS
TAVSGEYGLVWCFNCNACELEMADEEHAPTSRKRVAGTQINKDNPEPDDDSTEQEMGTFK
RASEEVMATRRIVKVRRQQPSSAPSNPFSAIRFTPSDTSAQATIPVSEPQPSDVITANAK
DSSSEKADEGSNGSGKDALPVTDKSAGSSEVAETEKDGSDLKGSDEKAKSSDSIEPPSQP
VETTDEAKDLGGGSVVAGEAKEDNSKASDIEDKTAKEGDAEEEDGANEAGAEDKISKGDD
EKKDGDESETKDGSSEEQKDADNKGQSSSPTPLFSFKNLSSGQNAFTGLAGTGFSGSSFS
FGSGSKESSSAPLFGLKTDGSSFPSFSIGASNNGSSSPALATSAEAPKKFAMPEGPVETG
EENEKAIFTADSALYEYLDGGWKERGKGELKLNIPVSGGERSRLVMRTKGNYRLVLNASL
YEDMSLKDMDKKGVTFACMNSIGDSQSGLATFALKFRDTSIREEFKAAVEMHKAKKASGT
LKTPENSPKASDD
Download sequence
Identical sequences OsIBCD017593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]