SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD017620 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD017620
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Ran-binding domain 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017620
Sequence length 188
Comment 188
Sequence
MAVAPIVRLEEVAVTTGEEDEDVLLDMKAKLYRFDKEGNQWKERGTGTVKLLKHKENGKV
RLVMRQAKTLKICANHLVASTTKMQEHAGSDKSCVWHAADFADGELKEEMFAIRFGSVEN
CKKFKDLVEEISESLAKTEGKETVEDSSAAGLLEKLSVTEKKSEEVATKEESTEAVKETD
TKSAATSE
Download sequence
Identical sequences B8AX15
OsIBCD017620 39946.BGIOSIBCE018640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]