SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD017685 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD017685
Domain Number 1 Region: 300-474,517-563
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.59e-40
Family Phospholipase D 0.058
Further Details:      
 
Domain Number 2 Region: 704-923
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.41e-28
Family Nuclease 0.051
Further Details:      
 
Domain Number 3 Region: 221-326
Classification Level Classification E-value
Superfamily PH domain-like 0.00000336
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017685
Sequence length 1046
Comment 1046
Sequence
MNVERLVPGGGGGGGGRFRYERMPARGPADDGEGEEEEEEAAVPERRPEVLAASASFRLS
EAAWVFEELPRASIVAVSRPDAGDITPMLLSYTIEVHYKQFRWRLYKKASQVLYLHFALK
RREFLEEFHEKQEQVKEWLQNLGIGEHMPVGHDEDEADDVNVPAQAEENSIRHRNVPSSA
VLPVIRPALGRQHSVSDRAKVAMQEYLNHFLGNLDIVNSPEVWVVLKPGFLALLKDPFDP
KLLDVLIFDALPHMDISGEGQISLAKEIKERNPLHFGLQVSSGGRTLKLRTRSSSKVKDW
VSAINAARQTPEGWCYPHRFGSFAPPRGLMPDGSMVQWFIDGEAAFQAIASSIEQAKSEI
FITGWWLCPELFLRRPFQHHGSSRLDALLEARAKQGVQIYILLYKEVALALKINSLYSKQ
KLLNIHENVKVLRYPDHFSSGVYLWSHHEKIVIVDNQVCYLGGLDLCFGRYDNSAHKLSD
VPPVIWPGKDYYNPRESEPNSWEDTMKDELDRTKYPRMPWHDVQCALYGPPCRDVARHFV
QRWNYAKRNKAPNEQGIPLLMPHHHMVIPHYKGIGQEINSEADGKQNHDKDCDVKKPVSV
DSRESCQDIPLLLPQELEPPALPNGDLRVNDLDANHSDHLHKTSFNQPLLNRKAKLDSSR
QDLPMRGFVDNISSLESSSIRHFDSSKEEKYHMDKNWWEMQERGDQVASVLDIGQVGPRA
TCHCQVIRSVGQWSAGTTQIEGSIHNAYFSLIEKAEHFVYIENQFFISGLSGDETIKNRV
LEALYRRILRAEREKKRFKAIIIIPLLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSI
LQNLYDVIGPKAHDYISFYGLRAHGRLCEGGPLVTNQIYVHSKLMIIDDRITLIGSANIN
DRSLLGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIM
DPIDDSTFKNIWMATAKVTSTIDLWGCHKRCVETYQDGDLKGTDPIERLQMIKGHLVSFP
LDFMSQEDLRPYFSESEYYTSPQVFH
Download sequence
Identical sequences 39946.BGIOSIBCE018697 OsIBCD017685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]