SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD017998 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD017998
Domain Number 1 Region: 84-231
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.2e-40
Family Glutathione S-transferase (GST), C-terminal domain 0.0000895
Further Details:      
 
Domain Number 2 Region: 12-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.62e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017998
Sequence length 274
Comment 274
Sequence
MEKQENGGEAPELKLFGSWASSYTHRVQLALRLKALEFVYAEEDLGNKSEALLRLNPVHK
KVPVLVHRGRPLAESVIILQYLDDAWPESRPLLPSDPFDRALARFWCHFADDKLGPAVGA
VFASTGKEQEAAVQQVHDNLALLEAELREGAFKGRRFFGGDQVGLLDVVLGCGSYWLAVF
EEVTGVRLVDADAFPLFHAWLRDFEAQEEVKETIPSVDRLLEYARGLRQMLLALAAGAGA
GAAAAAGSSPVTAAVDAPAPAAPPAAPQAAAVDI
Download sequence
Identical sequences A0A0E0HEF7 A2Y4N3 I1PVL9
ONIVA05G17100.1 OsIBCD017998 39946.BGIOSIBCE019033 ORGLA05G0141700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]