SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD018023 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD018023
Domain Number - Region: 252-301
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000258
Family PDI-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018023
Sequence length 439
Comment 439
Sequence
MALQSCCSSSASVPATCSALCLAEATRAASLFVRPRAAARRLVLARCARGREGGESKAVQ
LVLGGRARDDGSESESSDDEDDDEPMQMTDEQRRTLRRKIREMMDRVPETAEITDPAERK
AKMLELLTKYQLVVEEEDPNWPEDDEDGHGFSLGQFFDKITIKAEKKNDDDEEDDAKGNQ
SDKEIVWEDDNYIKPIRDVKTMDWDDTVFTDFGPLIVLVHNRYKRPQDNENARDQLVKAI
EMFWEYNLPSPRCVAVDACAEPDLVKALNVSGFPEVLFTNAGKIVHRDKVVRSAEEWTRM
MAFFYYKAARPPCLSEADGQGQEKITIAANASDHNSIAFHIDSSTKQPSTCKLYASLHSS
RWKKRERNPQIHAIKKGRKRVPKSTPHPSTKGKKKEQEEGNLKSMPHPSKKARYGGFFPL
HTTARSSKGAELLHEDNQI
Download sequence
Identical sequences 39946.BGIOSIBCE019058 OsIBCD018023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]