SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019090 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019090
Domain Number 1 Region: 198-341
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 6.02e-55
Family Nucleoside diphosphate kinase, NDK 0.000000181
Further Details:      
 
Domain Number 2 Region: 91-188
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000106
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  OsIBCD019090
Domain Number - Region: 55-89
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0641
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019090
Sequence length 344
Comment 344
Sequence
METPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLHLLSLPRIRWSSSTEDDDKIEL
TRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLSGYLYIRSRWTQLPGEPPILDD
ADVDDWLPRFVVLQGQCVYYYLKSTDLSPQESTLLCDIVEVGQLPNFVPEDEKTRYAFYI
MTSQGLKFECSSMSEIQVPVIKPDGVQRGLISEILSRFERKGFKLVAIKLVVPSKEFAQK
HYHDLKDRPFFNGLCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAV
VVGRNIIHGSDGPETAKAEIGLWFEPRELVSYTSNEEKWIYGVN
Download sequence
Identical sequences 39946.BGIOSIBCE020270 OsIBCD019090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]