SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019207 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019207
Domain Number 1 Region: 181-318
Classification Level Classification E-value
Superfamily Bet v1-like 1.17e-33
Family STAR domain 0.0074
Further Details:      
 
Domain Number 2 Region: 17-127
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000056
Family Phosphotyrosine-binding domain (PTB) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019207
Sequence length 624
Comment 624
Sequence
MARSGELPKVSAAATAAVRHEGWMLRYGRRKIGRSFVRTRYFVLDNKLLAYYKKQPKDNM
VPVKALQIDGNCRVEDRGLKTHHGQMVYVLCIYNKKEKENHITMGAHDIEDALVWKKKLE
LLIDQQQDTMTAKNRKAFASLDFDMEFGGPLSFSDRDSPPDSVHDWTKEPDIGLSDQNDT
NHAYSRKNWRLLRCQNGLRIFEELVEVEYLARSCSRAMRAVGVVEATCESIFGLIMSMDV
TRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWLVWPRDLCYVRYWRRNDDGSYVVLFRS
TEHQNCGPQPGFVRAFIERLREYFSQTDDIHPVPRIPVMSTMATVSKLKKDKKLQETDLK
TKQADFGQVDNKNLDMIDEESEEDDDYQVPEANLEEAPTRSDSDAKYTDPIDLSCFSGII
RRDANEKSRNCWTVPDSKLFKVRSESFPHDKSKVQTLKVAQQVPATKYLMELVAIDWLRD
IKRMDHVARRKGCAAQVAAEKGMFTFVVNIQIPGSSHYSLVLYFVTRTLEKGSLLQRFAD
GDDDFRNSRLKLIPSVPKVDVDIGSSAVANGVLGLVFGVVTTLIVDMAFLIQANTYDELP
EQLLGAARLSNIEPSSAIVPVLDK
Download sequence
Identical sequences 39946.BGIOSIBCE020412 OsIBCD019207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]