SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019413 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019413
Domain Number 1 Region: 2-90,140-206
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.27e-47
Family Eukaryotic glutathione synthetase ATP-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-142
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.47e-22
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00075
Further Details:      
 
Domain Number 3 Region: 214-262
Classification Level Classification E-value
Superfamily F-box domain 0.000000327
Family F-box domain 0.01
Further Details:      
 
Domain Number 4 Region: 376-549
Classification Level Classification E-value
Superfamily RNI-like 0.0000235
Family 28-residue LRR 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019413
Sequence length 683
Comment 683
Sequence
MMEVNKEEDIRLGLHRSDYMLDSGTNSLLQIELNTISSSFPGLSSLVSELHRTLLNRHGK
VLGLDSKRIPQNWAATQFAEALSMAWTEFNNKRDGQTVSVVYFRAGYSPNDYPSEAEWRA
RLLMEQSSAIKCPSISYHLVGTKKIQQELAKPNILERFLNNKEDIAKLRKCFAGLWSLDN
EEIVKTAIEKPDLFVLKPQREGGESPAVHADEVTTPMAIGAGGDRLSALPDDLLLRVLHF
ANAVEAASTSLLSRRFGALWRSSGAVNLAARVPGAGGRDAFVRAADAALAAAGRVVTRLT
LHVDDGDHSGYCTSMYNLLRDHDVVDAVVSHPAARRVEELRVAVAVHPFGHDKINTMISS
GSVRIYDIKLASLPSKTLRVLKLKAPASRHLSDMVFLRVFPNIEHLELDGAYDTWNKTAA
AVASILHCCPVLRELKLNLVGTSKNSKRVQHFFRRNSQLGRSSTTRLRFPAATALTLINC
LTNGGMSGSVIDAPRLRSLTYKGAARSQFELTSPAPDMKMVHLHFNHYFHQRDYLRFIHN
FTKVKVLKLKAEHGCPWRILPQHCSPRARRSTVSPDYFKNSKQVQHFFQRKSQLDFDRSI
DDFMRNSISKRGDHRHNGDEVSGFIPGLTACSFTCLQNNLRRVSLQFRLDENSENFGVRL
VKFFAENAMVLEELRVLTVETET
Download sequence
Identical sequences 39946.BGIOSIBCE020669 OsIBCD019413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]