SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019416 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019416
Domain Number 1 Region: 25-213,263-430
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.32e-124
Family Eukaryotic glutathione synthetase ATP-binding domain 0.000000845
Further Details:      
 
Domain Number 2 Region: 211-265
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-22
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019416
Sequence length 439
Comment 439
Sequence
MSAEAPLGVTPAAAAAEGEEMVAVVDEMAEEAAVWCAVHGLVVGDRAEPRSGTIPGVGLV
HAPFALLPTRFPASFWKQARELAPIFNDLVDRVSLDGEFLQDSLSRTRQVDDFTSRLLDI
HAKMMEVNKEEDIRLGLHRSDYMLDSETNSLLQIELNTISSSFPGLSSLVSELHRTLLNR
HGKVLGLDSKRIPQNWVATQFAEALSMAWTEFNNKRDGQTVSVVYFRAGYSPNDYPSEAE
WRARLLMEQSSAIKCPSISYHLVGTKKIQQELAKPNILERFLNNKEDIAKLRKCFAGLWS
LDNEEIVKTAIEKPDLFVLKPQREGGGNNIYGHDLRETLVRLQKEQGEALAAYILMQRIF
PRASLTHLVQGGVCFEDLTISELGIFGAYLRNKDKVVLNNQCGYLMRTKVSSSNEGGVAA
GFAVLDSILLTDEVILRTN
Download sequence
Identical sequences 39946.BGIOSIBCE020672 OsIBCD019416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]