SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019521 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019521
Domain Number 1 Region: 67-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-23
Family PDI-like 0.0059
Further Details:      
 
Domain Number 2 Region: 414-525
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.69e-19
Family PDI-like 0.0023
Further Details:      
 
Domain Number 3 Region: 277-405
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-17
Family PDI-like 0.062
Further Details:      
 
Domain Number 4 Region: 182-289
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000214
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019521
Sequence length 543
Comment 543
Sequence
MRARRVVAAAAVLLLFAVVAVARLDLDDDGDDSEVLDELLAVDEEEERGELGGGGEAAAA
EAVRRAQSMVLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAALRAMGSA
VAFAKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPASR
IQSKDSAEEFLKKDQTFAVGLFKNFEGAEYEEFVKAATSENEVQFVETNDRNVAKILFPG
IASEEQFLGLVKSEPEKFEKFNGAFEEKEIIQFVELNKFPLITVFTDLNSGKVYGSPIKL
QVFTFAEAYDFEDLESMIQEVARGFKTKIMLIYVDTAEEKLAKPFLTLYGLEPEKPTVTA
FDTSKGTKYLMEAEINAKNLQDFCLSLLEGTLPPYFRSEPVPEENVSSSLNILQKGPIEK
VVGRTFDSSVLESPQNVFLEVHAPWCVDCEAISKNVEKLAKHFNDLGQTNLKFARIDASV
NEHPKLQINNYPTLLLYPAQDKSNPIKLSKKSNLKDMAKFVKEKLQIADVETVAAGDIVK
DEL
Download sequence
Identical sequences 39946.BGIOSIBCE020784 OsIBCD019521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]