SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019547 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019547
Domain Number 1 Region: 137-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000136
Family Glutathione S-transferase (GST), C-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019547
Sequence length 303
Comment 303
Sequence
MASAAAAAAEWEEAERKVLVARKAAFGLPTACPTCLPVLLYLRMCNVPFDIHVDSSFPDA
DHIPYVEFGECVAFNNEKGGVIEYLKEEKIVDLNSKHPSVSYSDVLSTKAMVMTWLSDAL
QYELWLASDGSIPHDIYFSDLSWPIGKILYWKKTREVKQQLGITKLNAAEKEEEIYQKAN
AAYDALSTRLGDQIFLFDNSPTDVDALFLGHALFVLNVLPDTSVLRSCLQKYDNLVNFTK
HLKVQLLEADSDSSATGLGSTDPSSSSTPRKRASSGRMQPVRGACSFAQHADGLGPQIFS
ASD
Download sequence
Identical sequences B8B398
OsIBCD019547 39946.BGIOSIBCE020816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]