SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019863 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019863
Domain Number 1 Region: 70-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000121
Family PDI-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019863
Sequence length 282
Comment 282
Sequence
MRWWPVLPLLLLAVAVAGAGDAAPVCTRPSAAEAIVGSPEACRSPLRRPLGVTEGDDAIL
ARAVNLLHANKEDFAAVLFYASWCPFSQECRLRFEKLACIFPTIRHLAIEESTVKLRTRY
RYGIHGYPTLFLINSTVRVRYHGPRTVKSLAAFYNDVSGINPSMDPAVGDDNIEPKRDCE
QEKCLFWSARTPENILQPDTYLTLAASFVILRLLYLFYPKITAFVKRTWSRRTLFTCLEQ
GKHKFNRVYPSKQGNLHDGARHATAWASKSLASVSIGEPSTS
Download sequence
Identical sequences B8B416
39946.BGIOSIBCE021162 OsIBCD019863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]