SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD020370 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD020370
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-16
Family Txnl5-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD020370
Sequence length 139
Comment 139
Sequence
MTVEKVDATVADFDAHFDKLFAAGDDAEGKVKLLLFLADRDASSNQTWCPDCNVAEPVIY
DRVEAAAKGKEKDVVLLRAYVGDKPTWRDPAHPWRADPRFRLTGVPTLIRWENGAAAARL
GDDEAHLADKVDAVVNAAN
Download sequence
Identical sequences A0A0E0A8V3 A0A0E0G4R3 A0A0E0PX36 A2YCB4 Q5Z9Z3
ONIVA02G13070.1 39946.BGIOSIBCE021693 39947.LOC_Os06g21550.1 OGLUM06G13660.1 XP_015641897.1.37577 LOC_Os06g21550.1|13106.m02307|protein LOC_Os06g21550.1|PACid:21933184 OsIBCD020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]