SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD020776 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD020776
Domain Number 1 Region: 1176-1373,1442-1485
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.29e-41
Family Pyruvate phosphate dikinase, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD020776
Sequence length 1486
Comment 1486
Sequence
MALRSAIPTPSHLELRSLPRRPGEGWAATLAGMSGFSAAAAAAERCALGLGVHARPASPS
PALLPPAALRRGRRLPAATTTLAVSRRSLLAPRAIAASTGRASPGLVGRFTLDANSELKV
TLNPAPQGSVAEINLEATNTSGSLILHWGALRPDRGEWLLPSRKPDGTTVYKNRALRTPF
IKSGDNSTLKIEIDDPAVQAIEFLIFDEARNNWYKNNGQNFQIQLQASQYQGQGTSTATS
STVVPEDLVQIQSYLRWERKGKQSYTPEQEKACPEEYEAARTELIEELNKGVSLEKLRAK
LTKTPEATDSNAPASESTVTTKVPEELVQVQAYIRWEKAGKPNYAPEKQLVEFEEARKEL
QSELDKGTSVEQLRNKILKGNIETKVSKQLKDKKYFSVERIQRKKRDIVQLLKKHKPTVM
EAQAETPKQPTVLDLFTKSLQEQDNCEVLSRKLFKFGDKEILGITTVALGKTKVHLATNY
MEPLILHWALSKENGEWQAPPSSILPSGSSLLDKACETSFSEYELNGLHCQVVEIELDDG
GYKRMPFVLRSGETWMKNNGSDFYLDFSTKDTGDAGKGTAKALLERIADLEEDAQRSLMH
RFNIAADLVDQARDNGLLGIIGIFVWIRFMATRQLIWNKNYNVKPREISKAQDRFTDDLE
NMYRTYPQYQEILRMIMSAVGRGGEGDVGQRIRDEILVIQRNNDCKGGMMEEWHQKLHNN
TSPDDVVICQALLDYIKSDFDIGVYWDTLKKDGITKERLLSYDRPIHSEPNFRSEQKDGL
LRDLGNYMRSLKAVHSGADLESAIATCMGYKSEGEGFMVGVQINPVKGLPSGFPKLLEFV
LDHVEDKSAEPLLEGLLEARAELHPLLLGSPERMKDLIFLDIALDSTFRTAVERSYEELN
NVEPEKIMYFISLVLENLALSTDDNEDILYCLKGWNQALEMAKQKNNQWALYAKAFLDRT
RLALASKGEQYYNLMQPSAEYLGSLLNIDQWAVNIFTEEIIRGGSAATLSALLNRIDPVL
RNVAQLGSWQVISPVEVSGYIVVVDELLAVQNKSYDKPTILVAKSVKGEEEIPDGVVGVI
TPDMPDVLSHVSVRARNCKVLFATCFDPNTLSELQGHDGKVFSFKPTSADITYREIPESE
LQSGSLNAEAGQAVPSVSLVKKKFLGKYAISAEEFSEEMVGAKSRNVAYLKGKVPSWVGV
PTSVAIPFGTFEKVLSDEINKEVAQTIQMLKGKLAQDDFSALGEIRKTVLNLTAPTQLIK
ELKEKMLGSGMPWPGDEGDQRWEQAWMAIKKVWASKWNERAYFSTRKVKLDHDYLSMAVL
VQEIVNADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVGAYPGRAMSFVCKKNDLDSPK
VLGFPSKPIGLFIKRSIIFRSDSNGEDLEGYAGAGLYDSVPMDEEDEVILDYTTDPLITD
QGFQKSILSSIARAGHAIEELYGSPQDVEGAVKEGKLYVVQTRPQM
Download sequence
Identical sequences OsIBCD020776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]