SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD021131 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD021131
Domain Number 1 Region: 324-458
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.2e-49
Family eEF1-gamma domain 0.00014
Further Details:      
 
Domain Number 2 Region: 73-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.15e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0056
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0049
Further Details:      
 
Domain Number 4 Region: 256-283
Classification Level Classification E-value
Superfamily eEF1-gamma domain 0.0000000902
Family eEF1-gamma domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD021131
Sequence length 458
Comment 458
Sequence
MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP
EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG
PYVPALEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSFT
SEFPHVERYFWTMVNQPNFKKVIGDFKQAESVPPVQKKAAPPKESKAKEAKKEAPKEAPK
PKVEASEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREIAIKAPAPAPPLLE
LELSQTVSAPPKLGVELGGALSQNRHYHVYFPGFWDMYDPEGYSLWFCDYKYNDENTVSF
VTMNKVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELY
EWTKVDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK
Download sequence
Identical sequences B8B3U4
OsIBCD021131 39946.BGIOSIBCE022362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]