SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD022044 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD022044
Domain Number 1 Region: 191-412
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 9.8e-41
Family Zn metallo-beta-lactamase 0.011
Further Details:      
 
Domain Number 2 Region: 468-674
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.93e-30
Family Thioltransferase 0.046
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000185
Family LysR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD022044
Sequence length 679
Comment 679
Sequence
MTTGNLTEAAALLQTSQPTVSRELARFEKLIRLQLFDRVRGRLSPTVQGLRLFEEVQRSY
YGLDRIVNAAAGIRQFQQAQLSIVCLPVFSQSLLPAIDRHLRMTLQILGDGPHQRRLSER
LRTGDAQQAAQFVALPFLHQIDFPRQRQHLSAALQSTLTGVGPLPMFKKSLLTLAFTGVA
TLSTYATAADTLTMEVYNPGEKSVFPVSSEIVSGKHEVALIDAQFQRNDAEELVKKIKAT
GKKLTTVYISHSDPDFYFGLDVIKAAFPEAKIIASPGTIKDINATKDGKIAYWGPILKDN
APKTVIVPQPLQGDSFTIDGQKVEVKGLNGPTPDRTFVWIPALKAVVGGVAVAGDNIHPW
IADNQSVESRQHWQQTLKNIEALKPQVVVPGHFLPGAAQTLASVHFTQKYLTTLEAELPK
AKDSAALIEAMKKHYPTLKDESSLELSAKPWRRGGLPRAKRGVKMTETTLHYIFDPLCGW
CYGAAPLVKAAQSLPGLKVVPHAGGMMTGNNRRQITDEWRNYVIPHDKRIAEMTGQPFGE
AYFNGLLRDTTAVMDSEPPITAILAAEKLAGRGLDMLHRIQQAHYQEGRRIADTPVLEAL
AKELGLPSAAFIAEMRFNSGAPTAQHIAESRALLAKVQGQGFPTFALQDSEGQLHLLPAG
NYLGNVEAWKNLLGAAALA
Download sequence
Identical sequences OsIBCD022044 39946.BGIOSIBCE023329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]