SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD022298 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD022298
Domain Number - Region: 19-63
Classification Level Classification E-value
Superfamily PH domain-like 0.000879
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number - Region: 143-200
Classification Level Classification E-value
Superfamily Peptide deformylase 0.0471
Family Peptide deformylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD022298
Sequence length 422
Comment 422
Sequence
MASSGSSTVVGEMESSLERLRKWNERWVILDPATGKMEYKIRRSDAAVRGIIVFDSTSTV
TLSPMNFHASQLVLQAHKEAVNSLGGNGPTKLGKVATVVAVANATAIEASKEVEAAMKVS
LRAALGSTTNKLSKGQLDDLTIMMETLRVKDDELHQLLQDIRARDATIREITDKLQETAE
AAETAASAAHSIDEQRRFLSSELERLKQDQEKQIEFSLLRLRESEEKAKLLSEEREHLLK
ERDSALQEAQMWRSELGKARGNAVILEAAVVRAEEKARVSAADADMRINDAASRLDSATK
EKEELVALVDALQLQIRSQDTSTKQVCEERSELCSTSSKHVDMEDDNVDKACLSDTDPIP
ITENIVDLDDDGVDIPTIGVTEWNNPHSSEVSDVREVTTEPEDNSLDIPVDSQPVSENAF
HG
Download sequence
Identical sequences OsIBCD022298 39946.BGIOSIBCE023636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]