SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD022577 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD022577
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.53e-36
Family Thioltransferase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD022577
Sequence length 122
Comment 122
Sequence
MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGA
VFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASA
SA
Download sequence
Identical sequences A0A0D3GN47 A0A0E0DSY4 A0A0E0HXK6 A0A0E0Q501 A2YIW7 Q0D840
ONIVA07G04390.1 39946.BGIOSIBCE023952 39947.LOC_Os07g08840.1 OBART07G05580.1 LOC_Os07g08840.1|PACid:21900285 LOC_Os07g08840.1|13107.m00879|protein OsIBCD022577 OMERI05G16960.1 000158542|e1wmjA1|2485.1.1.40|A:9-130 d1wmja_ XP_015647572.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]